SCOPe 2.08: Domain d1rdfa_: 1rdf A:

Lineage for d1rdfa_ (1rdf A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.3: Phosphonoacetaldehyde hydrolase-like [56792] (3 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein Phosphonoacetaldehyde hydrolase [56793] (1 species)

7. Species Bacillus cereus [TaxId:1396] [56794] (6 PDB entries)
   Uniprot O31156

8. Domain d1rdfa_: 1rdf A: [104884]
   complexed with esa, mg; mutant

Details for d1rdfa_

PDB Entry: 1rdf, 2.8 Å

PDB Description: g50p mutant of phosphonoacetaldehyde hydrolase in complex with substrate analogue vinyl sulfonate

PDB Compounds: (A:) phosphonoacetaldehyde hydrolase

SCOPe Domain Sequences for d1rdfa_:

Sequence; same for both SEQRES and ATOM records:

>d1rdfa_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]}
kieavifdwagttvdygcfaplevfmeifhkrgvaitaeearkpmpllkidhvraltemp
riasewnrvfrqlpteadiqemyeefeeilfailpryaspinavkeviaslrergikigs
ttgytremmdivakeaalqgykpdflvtpddvpagrpypwmcyknamelgvypmnhmikv
gdtvsdmkegrnagmwtvgvilgsselglteeevenmdsvelrekievvrnrfvengahf
tietmqelesvmehiekqeliis

Timeline for d1rdfa_:

• d1rdfa_ first appeared in SCOP 1.69
  
• d1rdfa_ appears in SCOPe 2.07