Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.6: PLP-binding barrel [51419] (2 families) circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand |
Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins) |
Protein Alanine racemase [51421] (3 species) |
Species Pseudomonas aeruginosa [TaxId:287] [110345] (1 PDB entry) Uniprot Q9HTQ2 |
Domain d1rcqa2: 1rcq A:8-233 [104883] Other proteins in same PDB: d1rcqa1 complexed with dly, plp |
PDB Entry: 1rcq (more details), 1.45 Å
SCOPe Domain Sequences for d1rcqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rcqa2 c.1.6.1 (A:8-233) Alanine racemase {Pseudomonas aeruginosa [TaxId: 287]} idlqalrhnyrlareatgaralavikadayghgavrcaealaaeadgfavacieeglelr eagirqpilllegffeaselelivahdfwcvvhcawqleaieraslarplnvwlkmdsgm hrvgffpedfraaherlrasgkvakivmmshfsradeldcprteeqlaafsaasqglege islrnspavlgwpkvpsdwvrpgillygatpferahpladrlrpvm
Timeline for d1rcqa2: