Lineage for d1r9oa1 (1r9o A:26-490)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005388Protein Mammalian cytochrome p450 2c9 [89118] (1 species)
  7. 2005389Species Human (Homo sapiens) [TaxId:9606] [89119] (4 PDB entries)
    Uniprot P11712
  8. 2005390Domain d1r9oa1: 1r9o A:26-490 [104878]
    Other proteins in same PDB: d1r9oa2
    complexed with flp, gol, hem

Details for d1r9oa1

PDB Entry: 1r9o (more details), 2 Å

PDB Description: Crystal Structure of P4502C9 with Flurbiprofen bound
PDB Compounds: (A:) Cytochrome P450 2C9

SCOPe Domain Sequences for d1r9oa1:

Sequence, based on SEQRES records: (download)

>d1r9oa1 a.104.1.1 (A:26-490) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]}
rgklppgptplpvignilqigikdisksltnlskvygpvftlyfglkpivvlhgyeavke
alidlgeefsgrgifplaeranrgfgivfsngkkwkeirrfslmtlrnfgmgkrsiedrv
qeearclveelrktkaspcdptfilgcapcnvicsiifhkrfdykdqqflnlmeklneni
kilsspwiqicnnfspiidyfpgthnkllknvafmksyilekvkehqesmdmnnpqdfid
cflmkmekekhnqpseftieslentavdlfgagtettsttlryalllllkhpevtakvqe
eiervigrnrspcmqdrshmpytdavvhevqryidllptslphavtcdikfrnylipkgt
tilisltsvlhdnkefpnpemfdphhfldeggnfkkskyfmpfsagkricvgealagmel
flfltsilqnfnlkslvdpknldttpvvngfasvppfyqlcfipi

Sequence, based on observed residues (ATOM records): (download)

>d1r9oa1 a.104.1.1 (A:26-490) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]}
rgklppgptplplqigikdisksltnlskvygpvftlyfglkpivvlhgyeavkealidl
geefsgrgifplaeranrgfgivfsngkkwkeirrfslmtlrnfgmgkrsiedrvqeear
clveelrktkaspcdptfilgcapcnvicsiifhkrfdykdqqflnlmeklnenikilss
pwipiidyfpgthnkllknvafmksyilekvkehqesmdmnnpqdfidcflmkmekekhn
qpseftieslentavdlfgagtettsttlryalllllkhpevtakvqeeiervigrnrsp
cmqdrshmpytdavvhevqryidllptslphavtcdikfrnylipkgttilisltsvlhd
nkefpnpemfdphhfldeggnfkkskyfmpfsagkricvgealagmelflfltsilqnfn
lkslvdpknldttpvvngfasvppfyqlcfipi

SCOPe Domain Coordinates for d1r9oa1:

Click to download the PDB-style file with coordinates for d1r9oa1.
(The format of our PDB-style files is described here.)

Timeline for d1r9oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r9oa2