SCOP 1.75: Domain d1r9mc2: 1r9m C:509-766

Lineage for d1r9mc2 (1r9m C:509-766)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82499] (29 PDB entries)
   Uniprot P27487 39-776
   Uniprot P27487
   Uniprot P27487
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d1r9mc2: 1r9m C:509-766 [104875]
   Other proteins in same PDB: d1r9ma1, d1r9mb1, d1r9mc1, d1r9md1

Details for d1r9mc2

PDB Entry: 1r9m, 2.1 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv at 2.1 ang. resolution.

PDB Compounds: (C:) dipeptidyl peptidase IV

SCOP Domain Sequences for d1r9mc2:

Sequence; same for both SEQRES and ATOM records:

>d1r9mc2 c.69.1.24 (C:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

Timeline for d1r9mc2:

• d1r9mc2 first appeared in SCOP 1.69
  
• d1r9mc2 appears in SCOP 1.73
  
• d1r9mc2 appears in SCOPe 2.01
  
• d1r9mc2 appears in the current release, SCOPe 2.08