Lineage for d1r9mb2 (1r9m B:509-766)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 491701Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 491702Superfamily c.69.1: alpha/beta-Hydrolases [53474] (32 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 492291Family c.69.1.24: Dipeptidyl peptidase IV/CD26, C-terminal domain [82497] (1 protein)
    N-terminal domain is a 8-bladed beta-propeller
  6. 492292Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 492293Species Human (Homo sapiens) [TaxId:9606] [82499] (10 PDB entries)
  8. 492301Domain d1r9mb2: 1r9m B:509-766 [104873]
    Other proteins in same PDB: d1r9ma1, d1r9mb1, d1r9mc1, d1r9md1

Details for d1r9mb2

PDB Entry: 1r9m (more details), 2.1 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv at 2.1 ang. resolution.

SCOP Domain Sequences for d1r9mb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r9mb2 c.69.1.24 (B:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens)}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOP Domain Coordinates for d1r9mb2:

Click to download the PDB-style file with coordinates for d1r9mb2.
(The format of our PDB-style files is described here.)

Timeline for d1r9mb2: