Lineage for d1r9ka_ (1r9k A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450132Fold a.168: SopE-like GEF domain [81831] (1 superfamily)
    multihelical; consists of two all-alpha subdomains each containing a 3-helical bundle with right-handed twist
  4. 450133Superfamily a.168.1: SopE-like GEF domain [81832] (1 family) (S)
  5. 450134Family a.168.1.1: SopE-like GEF domain [81833] (2 proteins)
    C-terminal part of Pfam 05364
  6. 450135Protein Effector protein SopE2 [109939] (1 species)
  7. 450136Species Salmonella typhimurium [TaxId:90371] [109940] (2 PDB entries)
  8. 450138Domain d1r9ka_: 1r9k A: [104869]

Details for d1r9ka_

PDB Entry: 1r9k (more details)

PDB Description: representative solution structure of the catalytic domain of sope2

SCOP Domain Sequences for d1r9ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r9ka_ a.168.1.1 (A:) Effector protein SopE2 {Salmonella typhimurium}
egravltsktvkdfmlqklnsldikgnaskdpayarqtceailsavysnnkdqcckllis
kgvsitpflkeigeaaqnaglpgeikngvftpggaganpfvvpliasasikyphmfinhn
qqvsfkayaekivmkevtplfnkgtmptpqqfqltieniankylqnas

SCOP Domain Coordinates for d1r9ka_:

Click to download the PDB-style file with coordinates for d1r9ka_.
(The format of our PDB-style files is described here.)

Timeline for d1r9ka_: