![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.168: SopE-like GEF domain [81831] (1 superfamily) multihelical; consists of two all-alpha subdomains each containing a 3-helical bundle with right-handed twist |
![]() | Superfamily a.168.1: SopE-like GEF domain [81832] (1 family) ![]() |
![]() | Family a.168.1.1: SopE-like GEF domain [81833] (3 proteins) C-terminal part of Pfam PF05364 |
![]() | Protein Effector protein SopE2 [109939] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [109940] (2 PDB entries) Uniprot Q9KIZ2 |
![]() | Domain d1r9ka_: 1r9k A: [104869] |
PDB Entry: 1r9k (more details)
SCOPe Domain Sequences for d1r9ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r9ka_ a.168.1.1 (A:) Effector protein SopE2 {Salmonella typhimurium [TaxId: 90371]} egravltsktvkdfmlqklnsldikgnaskdpayarqtceailsavysnnkdqcckllis kgvsitpflkeigeaaqnaglpgeikngvftpggaganpfvvpliasasikyphmfinhn qqvsfkayaekivmkevtplfnkgtmptpqqfqltieniankylqnas
Timeline for d1r9ka_: