Lineage for d1r9ka_ (1r9k A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735783Fold a.168: SopE-like GEF domain [81831] (1 superfamily)
    multihelical; consists of two all-alpha subdomains each containing a 3-helical bundle with right-handed twist
  4. 2735784Superfamily a.168.1: SopE-like GEF domain [81832] (1 family) (S)
  5. 2735785Family a.168.1.1: SopE-like GEF domain [81833] (3 proteins)
    C-terminal part of Pfam PF05364
  6. 2735791Protein Effector protein SopE2 [109939] (1 species)
  7. 2735792Species Salmonella typhimurium [TaxId:90371] [109940] (2 PDB entries)
    Uniprot Q9KIZ2
  8. 2735794Domain d1r9ka_: 1r9k A: [104869]

Details for d1r9ka_

PDB Entry: 1r9k (more details)

PDB Description: representative solution structure of the catalytic domain of sope2
PDB Compounds: (A:) TypeIII-secreted protein effector: invasion-associated protein

SCOPe Domain Sequences for d1r9ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r9ka_ a.168.1.1 (A:) Effector protein SopE2 {Salmonella typhimurium [TaxId: 90371]}
egravltsktvkdfmlqklnsldikgnaskdpayarqtceailsavysnnkdqcckllis
kgvsitpflkeigeaaqnaglpgeikngvftpggaganpfvvpliasasikyphmfinhn
qqvsfkayaekivmkevtplfnkgtmptpqqfqltieniankylqnas

SCOPe Domain Coordinates for d1r9ka_:

Click to download the PDB-style file with coordinates for d1r9ka_.
(The format of our PDB-style files is described here.)

Timeline for d1r9ka_: