Lineage for d1r8xb_ (1r8x B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 490261Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 490262Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (39 families) (S)
  5. 490288Family c.66.1.5: Glycine N-methyltransferase [53348] (1 protein)
  6. 490289Protein Glycine N-methyltransferase [53349] (3 species)
  7. 490293Species Mouse (Mus musculus) [TaxId:10090] [110665] (2 PDB entries)
  8. 490295Domain d1r8xb_: 1r8x B: [104856]

Details for d1r8xb_

PDB Entry: 1r8x (more details), 2.95 Å

PDB Description: crystal structure of mouse glycine n-methyltransferase (tetragonal form)

SCOP Domain Sequences for d1r8xb_:

Sequence, based on SEQRES records: (download)

>d1r8xb_ c.66.1.5 (B:) Glycine N-methyltransferase {Mouse (Mus musculus)}
vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgtgrdgspgfskfrl
syyphclasftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd

Sequence, based on observed residues (ATOM records): (download)

>d1r8xb_ c.66.1.5 (B:) Glycine N-methyltransferase {Mouse (Mus musculus)}
vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgfskfrlsyyphcla
sftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd

SCOP Domain Coordinates for d1r8xb_:

Click to download the PDB-style file with coordinates for d1r8xb_.
(The format of our PDB-style files is described here.)

Timeline for d1r8xb_: