Lineage for d1r8o.1 (1r8o A:,B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.4: STI-like [50386] (3 families) 
Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
automatically mapped to Pfam PF00197
Protein Two-chain trypsin inhibitor [110215] (1 species) Species Balsam copaiba (Copaifera langsdorffii) [TaxId:280048] [110216] (1 PDB entry)
Uniprot P84144,P84145 # two chains probably resulted from a single chain precursor
Domain d1r8o.1: 1r8o A:,B: [104852]
Details for d1r8o.1
PDB Entry: 1r8o (more details), 1.83 Å
PDB Description: Crystal structure of an unusual Kunitz-type trypsin inhibitor from Copaifera langsdorffii seeds
PDB Compounds: (A:) Kunitz trypsin inhibitor, (B:) Kunitz trypsin inhibitorSCOPe Domain Sequences for d1r8o.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1r8o.1 b.42.4.1 (A:,B:) Two-chain trypsin inhibitor {Balsam copaiba (Copaifera langsdorffii) [TaxId: 280048]}
rlvdtdgkpiendgaeyyilpsvrgkggglvlaksggekcplsvvqspselsnglpvrfk
asprskyisvgmllgieviespecapkpsmwsvksgXwklpsvtvgnpkvsvfggpfkie
egksgykdvyssskgrdlddgievnkkkekrlvvkdgnpfiirfkksg
SCOPe Domain Coordinates for d1r8o.1:
Click to download the PDB-style file with coordinates for d1r8o.1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r8o.1:
- d1r8o.1 first appeared in SCOP 1.69
- d1r8o.1 appears in SCOPe 2.07
View in 3D