Lineage for d1r8na_ (1r8n A:)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.4: STI-like [50386] (2 families) 
Family b.42.4.1: Kunitz (STI) inhibitors [50387] (7 proteins) 
Protein Serine protease inhibitor DrTI [110213] (1 species) Species Royal poinciana (Delonix regia) [TaxId:72433] [110214] (1 PDB entry) 
Domain d1r8na_: 1r8n A: [104851]
Details for d1r8na_
PDB Entry: 1r8n (more details), 1.75 Å
PDB Description: The Crystal Structure of the Kunitz (STI) Type Inhibitor from Seeds of Delonix regia
SCOP Domain Sequences for d1r8na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r8na_ b.42.4.1 (A:) Serine protease inhibitor DrTI {Royal poinciana (Delonix regia)}
sdaekvydiegypvflgseyyivsaiigaggggvrpgrtrgsmcpmsiiqeqsdlqmglp
vrfsspeekqgkiytdteleiefvekpdcaesskwvivkdsgearvaiggsedhpqgelv
rgffkieklgslayklvfcpksdsgscsdiginyegrrslvlkssddvpfrvvfvkprsg
setes
SCOP Domain Coordinates for d1r8na_:
Click to download the PDB-style file with coordinates for d1r8na_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r8na_:
- d1r8na_ is new in SCOP 1.69
- d1r8na_ appears in SCOP 1.71
- d1r8na_ appears in the current release, SCOPe 2.08
View in 3D