Lineage for d1r8ja1 (1r8j A:177-282)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018474Fold a.186: KaiA/RbsU domain [101214] (1 superfamily)
    4 helices; bundle, right-handed twist; right-handed superhelix
  4. 2018475Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families) (S)
  5. 2018476Family a.186.1.1: Circadian clock protein KaiA, C-terminal domain [101216] (1 protein)
  6. 2018477Protein Circadian clock protein KaiA, C-terminal domain [101217] (3 species)
  7. 2018480Species Synechococcus elongatus PCC 7942 [TaxId:1140] [109835] (1 PDB entry)
    Uniprot Q79PF6
  8. 2018481Domain d1r8ja1: 1r8j A:177-282 [104847]
    Other proteins in same PDB: d1r8ja2, d1r8ja3, d1r8jb2, d1r8jb3
    structured linker 136-176 in swapped dimer

Details for d1r8ja1

PDB Entry: 1r8j (more details), 2.03 Å

PDB Description: Crystal Structure of Circadian Clock Protein KaiA from Synechococcus elongatus
PDB Compounds: (A:) KaiA

SCOPe Domain Sequences for d1r8ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8ja1 a.186.1.1 (A:177-282) Circadian clock protein KaiA, C-terminal domain {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
rflrnlpayesqklhqamqtsyreivlsyfspnsnlnqsidnfvnmaffadvpvtkvvei
hmelmdefakklrvegrsedilldyrltlidviahlcemyrrsipr

SCOPe Domain Coordinates for d1r8ja1:

Click to download the PDB-style file with coordinates for d1r8ja1.
(The format of our PDB-style files is described here.)

Timeline for d1r8ja1: