Lineage for d1r8ja1 (1r8j A:177-282)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450326Fold a.186: KaiA/RbsU domain [101214] (1 superfamily)
    4 helices; bundle, right-handed twist; right-handed superhelix
  4. 450327Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families) (S)
  5. 450328Family a.186.1.1: Circadian clock protein KaiA, C-terminal domain [101216] (1 protein)
  6. 450329Protein Circadian clock protein KaiA, C-terminal domain [101217] (3 species)
  7. 450332Species Synechococcus elongatus PCC 7942 [TaxId:1140] [109835] (1 PDB entry)
  8. 450333Domain d1r8ja1: 1r8j A:177-282 [104847]
    Other proteins in same PDB: d1r8ja2, d1r8jb2

Details for d1r8ja1

PDB Entry: 1r8j (more details), 2.03 Å

PDB Description: Crystal Structure of Circadian Clock Protein KaiA from Synechococcus elongatus

SCOP Domain Sequences for d1r8ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8ja1 a.186.1.1 (A:177-282) Circadian clock protein KaiA, C-terminal domain {Synechococcus elongatus PCC 7942}
rflrnlpayesqklhqamqtsyreivlsyfspnsnlnqsidnfvnmaffadvpvtkvvei
hmelmdefakklrvegrsedilldyrltlidviahlcemyrrsipr

SCOP Domain Coordinates for d1r8ja1:

Click to download the PDB-style file with coordinates for d1r8ja1.
(The format of our PDB-style files is described here.)

Timeline for d1r8ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r8ja2