Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily) duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12) |
Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (5 families) |
Family d.60.1.1: Multidrug-binding domain of transcription activator BmrR [55137] (2 proteins) automatically mapped to Pfam PF06445 |
Protein Multidrug-binding domain of transcription activator BmrR [55138] (1 species) |
Species Bacillus subtilis [TaxId:1423] [55139] (6 PDB entries) Uniprot P39075 |
Domain d1r8ea2: 1r8e A:121-277 [104844] Other proteins in same PDB: d1r8ea1 protein/DNA complex; complexed with gol, imd, p4p |
PDB Entry: 1r8e (more details), 2.4 Å
SCOPe Domain Sequences for d1r8ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r8ea2 d.60.1.1 (A:121-277) Multidrug-binding domain of transcription activator BmrR {Bacillus subtilis [TaxId: 1423]} lgevfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpyt sidemtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyi adrqltvvsdvyeliipihyspkkqeeyrvemkiria
Timeline for d1r8ea2: