Lineage for d1r8ea2 (1r8e A:121-277)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956515Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily)
    duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12)
  4. 2956516Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (5 families) (S)
  5. 2956517Family d.60.1.1: Multidrug-binding domain of transcription activator BmrR [55137] (2 proteins)
    automatically mapped to Pfam PF06445
  6. 2956518Protein Multidrug-binding domain of transcription activator BmrR [55138] (1 species)
  7. 2956519Species Bacillus subtilis [TaxId:1423] [55139] (6 PDB entries)
    Uniprot P39075
  8. 2956520Domain d1r8ea2: 1r8e A:121-277 [104844]
    Other proteins in same PDB: d1r8ea1
    protein/DNA complex; complexed with gol, imd, p4p

Details for d1r8ea2

PDB Entry: 1r8e (more details), 2.4 Å

PDB Description: Crystal Structure of BmrR Bound to DNA at 2.4A Resolution
PDB Compounds: (A:) multidrug-efflux transporter regulator

SCOPe Domain Sequences for d1r8ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8ea2 d.60.1.1 (A:121-277) Multidrug-binding domain of transcription activator BmrR {Bacillus subtilis [TaxId: 1423]}
lgevfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpyt
sidemtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyi
adrqltvvsdvyeliipihyspkkqeeyrvemkiria

SCOPe Domain Coordinates for d1r8ea2:

Click to download the PDB-style file with coordinates for d1r8ea2.
(The format of our PDB-style files is described here.)

Timeline for d1r8ea2: