| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) ![]() |
| Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 proteins) includes a dimerisation, antiparallel coiled-coil subdomain |
| Protein Multidrug transporter activator MtaN [68976] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [68977] (2 PDB entries) Uniprot P71039 1-109 |
| Domain d1r8db_: 1r8d B: [104842] protein/DNA complex; complexed with so4 |
PDB Entry: 1r8d (more details), 2.7 Å
SCOPe Domain Sequences for d1r8db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r8db_ a.6.1.3 (B:) Multidrug transporter activator MtaN {Bacillus subtilis [TaxId: 1423]}
mkyqvkqvaeisgvsirtlhhydniellnpsaltdagyrlysdadlerlqqilffkeigf
rldeikemldhpnfdrkaalqsqkeilmkkkqrmdemiqtidrtlls
Timeline for d1r8db_: