SCOPe 2.08: Domain d1r8db_: 1r8d B:

Lineage for d1r8db_ (1r8d B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 proteins)
   includes a dimerisation, antiparallel coiled-coil subdomain

6. Protein Multidrug transporter activator MtaN [68976] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [68977] (2 PDB entries)
   Uniprot P71039 1-109

8. Domain d1r8db_: 1r8d B: [104842]
   protein/DNA complex; complexed with so4

Details for d1r8db_

PDB Entry: 1r8d, 2.7 Å

PDB Description: Crystal Structure of MtaN Bound to DNA

PDB Compounds: (B:) transcription activator MtaN

SCOPe Domain Sequences for d1r8db_:

Sequence; same for both SEQRES and ATOM records:

>d1r8db_ a.6.1.3 (B:) Multidrug transporter activator MtaN {Bacillus subtilis [TaxId: 1423]}
mkyqvkqvaeisgvsirtlhhydniellnpsaltdagyrlysdadlerlqqilffkeigf
rldeikemldhpnfdrkaalqsqkeilmkkkqrmdemiqtidrtlls

Timeline for d1r8db_:

• d1r8db_ first appeared in SCOP 1.69
  
• d1r8db_ appears in SCOPe 2.07