Lineage for d1r8db_ (1r8d B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 proteins)
    includes a dimerisation, antiparallel coiled-coil subdomain
  6. Protein Multidrug transporter activator MtaN [68976] (1 species)
  7. Species Bacillus subtilis [TaxId:1423] [68977] (2 PDB entries)
    Uniprot P71039 1-109
  8. Domain d1r8db_: 1r8d B: [104842]
    protein/DNA complex; complexed with so4

Details for d1r8db_

PDB Entry: 1r8d (more details), 2.7 Å

PDB Description: Crystal Structure of MtaN Bound to DNA
PDB Compounds: (B:) transcription activator MtaN

SCOPe Domain Sequences for d1r8db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8db_ a.6.1.3 (B:) Multidrug transporter activator MtaN {Bacillus subtilis [TaxId: 1423]}
mkyqvkqvaeisgvsirtlhhydniellnpsaltdagyrlysdadlerlqqilffkeigf
rldeikemldhpnfdrkaalqsqkeilmkkkqrmdemiqtidrtlls

SCOPe Domain Coordinates for d1r8db_ are not available.

Timeline for d1r8db_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r8da_