Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein Xylanase [51488] (6 species) |
Species Bacillus stearothermophilus, Xt6 [TaxId:1422] [69386] (8 PDB entries) Uniprot P40943 |
Domain d1r85a_: 1r85 A: [104839] complexed with cl, gol, so4, zn |
PDB Entry: 1r85 (more details), 1.45 Å
SCOPe Domain Sequences for d1r85a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} kphisalnapqldqrykneftigaavepyqlqnekdvqmlkrhfnsivaenvmkpisiqp eegkfnfeqadrivkfakangmdirfhtlvwhsqvpqwffldkegkpmvnetdpvkreqn kqlllkrlethiktiverykddikywdvvnevvgddgklrnspwyqiagidyikvafqaa rkyggdniklymndyntevepkrtalynlvkqlkeegvpidgighqshiqigwpseaeie ktinmfaalgldnqiteldvsmygwpprayptydaipkqkfldqaarydrlfklyeklsd kisnvtfwgiadnhtwldsradvyydangnvvvdpnapyakvekgkgkdapfvfgpdykv kpaywaiidhk
Timeline for d1r85a_: