SCOPe 2.08: Domain d1r7lb1: 1r7l B:1-101

Lineage for d1r7lb1 (1r7l B:1-101)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.277: Bacillus phage protein [111073] (1 superfamily)
   alpa-beta(3)-alpha-beta(3)-alpha; 3 layers: b/a/b, 3-helical bundle flanked by two 3-stranded meander beta-sheets

4. Superfamily d.277.1: Bacillus phage protein [111074] (1 family)

5. Family d.277.1.1: Bacillus phage protein [111075] (1 protein)

6. Protein Bacillus phage protein [111076] (1 species)

7. Species Bacillus cereus [TaxId:1396] [111077] (1 PDB entry)
   Uniprot Q81EU2; 100% sequence identity to a Bacteriophage phBC6A51 protein

8. Domain d1r7lb1: 1r7l B:1-101 [104838]
   Other proteins in same PDB: d1r7la2, d1r7lb2
   Structural genomics target

Details for d1r7lb1

PDB Entry: 1r7l, 2 Å

PDB Description: 2.0 A Crystal Structure of a Phage Protein from Bacillus cereus ATCC 14579

PDB Compounds: (B:) Phage protein

SCOPe Domain Sequences for d1r7lb1:

Sequence; same for both SEQRES and ATOM records:

>d1r7lb1 d.277.1.1 (B:1-101) Bacillus phage protein {Bacillus cereus [TaxId: 1396]}
mkprdinkliaskifgyeikddniikdgryrlgiplysqniesawqvvekleydvkvtkt
dlkpkyqvhvfvpggvkmvfaetapmaickgalasvdielq

Timeline for d1r7lb1:

• d1r7lb1 first appeared in SCOP 1.69, called d1r7lb_
  
• d1r7lb1 appears in SCOPe 2.07