![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.277: Bacillus phage protein [111073] (1 superfamily) alpa-beta(3)-alpha-beta(3)-alpha; 3 layers: b/a/b, 3-helical bundle flanked by two 3-stranded meander beta-sheets |
![]() | Superfamily d.277.1: Bacillus phage protein [111074] (1 family) ![]() |
![]() | Family d.277.1.1: Bacillus phage protein [111075] (1 protein) |
![]() | Protein Bacillus phage protein [111076] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [111077] (1 PDB entry) Uniprot Q81EU2; 100% sequence identity to a Bacteriophage phBC6A51 protein |
![]() | Domain d1r7lb1: 1r7l B:1-101 [104838] Other proteins in same PDB: d1r7la2, d1r7lb2 Structural genomics target |
PDB Entry: 1r7l (more details), 2 Å
SCOPe Domain Sequences for d1r7lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r7lb1 d.277.1.1 (B:1-101) Bacillus phage protein {Bacillus cereus [TaxId: 1396]} mkprdinkliaskifgyeikddniikdgryrlgiplysqniesawqvvekleydvkvtkt dlkpkyqvhvfvpggvkmvfaetapmaickgalasvdielq
Timeline for d1r7lb1: