Lineage for d1r7la1 (1r7l A:1-96)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009501Fold d.277: Bacillus phage protein [111073] (1 superfamily)
    alpa-beta(3)-alpha-beta(3)-alpha; 3 layers: b/a/b, 3-helical bundle flanked by two 3-stranded meander beta-sheets
  4. 3009502Superfamily d.277.1: Bacillus phage protein [111074] (1 family) (S)
  5. 3009503Family d.277.1.1: Bacillus phage protein [111075] (1 protein)
  6. 3009504Protein Bacillus phage protein [111076] (1 species)
  7. 3009505Species Bacillus cereus [TaxId:1396] [111077] (1 PDB entry)
    Uniprot Q81EU2; 100% sequence identity to a Bacteriophage phBC6A51 protein
  8. 3009506Domain d1r7la1: 1r7l A:1-96 [104837]
    Other proteins in same PDB: d1r7la2, d1r7lb2
    Structural genomics target

Details for d1r7la1

PDB Entry: 1r7l (more details), 2 Å

PDB Description: 2.0 A Crystal Structure of a Phage Protein from Bacillus cereus ATCC 14579
PDB Compounds: (A:) Phage protein

SCOPe Domain Sequences for d1r7la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r7la1 d.277.1.1 (A:1-96) Bacillus phage protein {Bacillus cereus [TaxId: 1396]}
mkprdinkliaskifgyeikddniikdgryrlgiplysqniesawqvvekleydvkvtkt
dlkpkyqvhvfvpggvkmvfaetapmaickgalasv

SCOPe Domain Coordinates for d1r7la1:

Click to download the PDB-style file with coordinates for d1r7la1.
(The format of our PDB-style files is described here.)

Timeline for d1r7la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r7la2