Lineage for d1r7ga_ (1r7g A:)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2651066Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)
  4. 2651067Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) (S)
  5. 2651068Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins)
    the member of this family may be not related
  6. 2651147Protein Membrane anchor domain of the nonstructural protein 5a (NS5a) [111509] (1 species)
  7. 2651148Species Hepatitis C virus [TaxId:11103] [111510] (5 PDB entries)
    Uniprot P27958 1972-2003
  8. 2651152Domain d1r7ga_: 1r7g A: [104835]

Details for d1r7ga_

PDB Entry: 1r7g (more details)

PDB Description: nmr structure of the membrane anchor domain (1-31) of the nonstructural protein 5a (ns5a) of hepatitis c virus (minimized average structure, sample in 100mm dpc)
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d1r7ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r7ga_ j.35.1.1 (A:) Membrane anchor domain of the nonstructural protein 5a (NS5a) {Hepatitis C virus [TaxId: 11103]}
sgswlrdiwdwicevlsdfktwlkaklmpql

SCOPe Domain Coordinates for d1r7ga_:

Click to download the PDB-style file with coordinates for d1r7ga_.
(The format of our PDB-style files is described here.)

Timeline for d1r7ga_: