SCOPe 2.06: Domain d1r7ga_: 1r7g A:

Lineage for d1r7ga_ (1r7g A:)

1. Root: SCOPe 2.06

2. Class j: Peptides [58231] (133 folds)

3. Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)

4. Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family)

5. Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins)
   the member of this family may be not related

6. Protein Membrane anchor domain of the nonstructural protein 5a (NS5a) [111509] (1 species)

7. Species Hepatitis C virus [TaxId:11103] [111510] (5 PDB entries)
   Uniprot P27958 1972-2003

8. Domain d1r7ga_: 1r7g A: [104835]

Details for d1r7ga_

PDB Entry: 1r7g

PDB Description: nmr structure of the membrane anchor domain (1-31) of the nonstructural protein 5a (ns5a) of hepatitis c virus (minimized average structure, sample in 100mm dpc)

PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d1r7ga_:

Sequence; same for both SEQRES and ATOM records:

>d1r7ga_ j.35.1.1 (A:) Membrane anchor domain of the nonstructural protein 5a (NS5a) {Hepatitis C virus [TaxId: 11103]}
sgswlrdiwdwicevlsdfktwlkaklmpql

Timeline for d1r7ga_:

• d1r7ga_ first appeared in SCOP 1.69
  
• d1r7ga_ appears in SCOPe 2.05
  
• d1r7ga_ appears in SCOPe 2.07
  
• d1r7ga_ appears in the current release, SCOPe 2.08