Class j: Peptides [58231] (133 folds) |
Fold j.35: Transmembrane helical fragments [58517] (1 superfamily) |
Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) |
Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins) the member of this family may be not related |
Protein Membrane anchor domain of the nonstructural protein 5a (NS5a) [111509] (1 species) |
Species Hepatitis C virus [TaxId:11103] [111510] (5 PDB entries) Uniprot P27958 1972-2003 |
Domain d1r7ga_: 1r7g A: [104835] |
PDB Entry: 1r7g (more details)
SCOPe Domain Sequences for d1r7ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r7ga_ j.35.1.1 (A:) Membrane anchor domain of the nonstructural protein 5a (NS5a) {Hepatitis C virus [TaxId: 11103]} sgswlrdiwdwicevlsdfktwlkaklmpql
Timeline for d1r7ga_: