Lineage for d1r7da_ (1r7d A:)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3046491Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)
  4. 3046492Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) (S)
  5. 3046493Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins)
    the member of this family may be not related
  6. 3046572Protein Membrane anchor domain of the nonstructural protein 5a (NS5a) [111509] (1 species)
  7. 3046573Species Hepatitis C virus [TaxId:11103] [111510] (5 PDB entries)
    Uniprot P27958 1972-2003
  8. 3046576Domain d1r7da_: 1r7d A: [104832]

Details for d1r7da_

PDB Entry: 1r7d (more details)

PDB Description: nmr structure of the membrane anchor domain (1-31) of the nonstructural protein 5a (ns5a) of hepatitis c virus (ensemble of 51 structures, sample in 50% tfe)
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d1r7da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r7da_ j.35.1.1 (A:) Membrane anchor domain of the nonstructural protein 5a (NS5a) {Hepatitis C virus [TaxId: 11103]}
sgswlrdiwdwicevlsdfktwlkaklmpql

SCOPe Domain Coordinates for d1r7da_:

Click to download the PDB-style file with coordinates for d1r7da_.
(The format of our PDB-style files is described here.)

Timeline for d1r7da_: