Lineage for d1r76a_ (1r76 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004784Superfamily a.102.5: Family 10 polysaccharide lyase [81853] (1 family) (S)
  5. 2004785Family a.102.5.1: Family 10 polysaccharide lyase [81854] (1 protein)
    incomplete toroid made of four hairpins
  6. 2004786Protein Polygalacturonic acid lyase (pectate lyase) [81855] (2 species)
  7. 2004787Species Azospirillum irakense [TaxId:34011] [109956] (1 PDB entry)
    Uniprot Q9X592
  8. 2004788Domain d1r76a_: 1r76 A: [104830]
    complexed with cl, gol, hg, ipa

Details for d1r76a_

PDB Entry: 1r76 (more details), 2.65 Å

PDB Description: Structure of a pectate lyase from Azospirillum irakense
PDB Compounds: (A:) pectate lyase

SCOPe Domain Sequences for d1r76a_:

Sequence, based on SEQRES records: (download)

>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]}
avigmneaasaltpsrvsslpdtqraawqeylarseaqlsrdkaslaaelapgqplpppp
aegkgadtmpldkpaawytskaarhvadvivsfqtpaggwgknqprdgalrlpgqhytge
nvakvksgsndldaardrdwhyvgtidndatvteirflaqvvsqlapeeaapyrdaalkg
ieyllasqfpnggwpqvwpleggyhdaitynddalvhvaellsdiaagrdgfgfvppair
traleatnaaihcivetqvvqdgkrlgwgqqhdaltlrptsarnfepaalsstesarill
flmeieapsdavkqairggvawlntsvirdrawvksdqgyqlvteqgakplwsrfysldg
nkpvfgdrdktihddvmgisqerrtgyawyttspqkalsaftkwekrs

Sequence, based on observed residues (ATOM records): (download)

>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]}
avigmneaasaltpsrvsslpdtqraawqeylarseaqlsrdkaslaaelapgqplpppp
aegkgadtmpldkpaawytskaarhvadvivsfqtpaggwgknqprdgalrlpgqhytge
nvakvkrdrdwhyvgtidndatvteirflaqvvsqlapeeaapyrdaalkgieyllasqf
pnggwpqvwpleggyhdaitynddalvhvaellsdiaagrdgfgfvppairtraleatna
aihcivetqvvqdgkrlgwgqqhdaltlrptsarnfepaalsstesarillflmeieaps
davkqairggvawlntsvirdqgakplwsrfysldgnkpvfgdrdktihddvmgisqerr
tgyawyttspqkalsaftkwekrs

SCOPe Domain Coordinates for d1r76a_:

Click to download the PDB-style file with coordinates for d1r76a_.
(The format of our PDB-style files is described here.)

Timeline for d1r76a_: