Lineage for d1r73a_ (1r73 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 437311Fold a.2: Long alpha-hairpin [46556] (14 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 437317Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 437318Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 437319Protein Ribosomal protein L29 (L29p) [46563] (2 species)
  7. 437340Species Thermotoga maritima [TaxId:243274] [109630] (1 PDB entry)
  8. 437341Domain d1r73a_: 1r73 A: [104827]
    Structural genomics target

Details for d1r73a_

PDB Entry: 1r73 (more details)

PDB Description: solution structure of tm1492, the l29 ribosomal protein from thermotoga maritima

SCOP Domain Sequences for d1r73a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r73a_ a.2.2.1 (A:) Ribosomal protein L29 (L29p) {Thermotoga maritima}
mkaselrnytdeelknlleekkrqlmelrfqlamgqlkntslikltkrdiariktilrer
elgirr

SCOP Domain Coordinates for d1r73a_:

Click to download the PDB-style file with coordinates for d1r73a_.
(The format of our PDB-style files is described here.)

Timeline for d1r73a_: