Lineage for d1r73a_ (1r73 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979497Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1979523Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
    automatically mapped to Pfam PF00831
  5. 1979524Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 1979525Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 1979607Species Thermotoga maritima [TaxId:2336] [109630] (1 PDB entry)
    Uniprot P38514
  8. 1979608Domain d1r73a_: 1r73 A: [104827]
    Structural genomics target

Details for d1r73a_

PDB Entry: 1r73 (more details)

PDB Description: Solution Structure of TM1492, the L29 ribosomal protein from Thermotoga maritima
PDB Compounds: (A:) 50S ribosomal protein L29

SCOPe Domain Sequences for d1r73a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r73a_ a.2.2.1 (A:) Ribosomal protein L29 (L29p) {Thermotoga maritima [TaxId: 2336]}
mkaselrnytdeelknlleekkrqlmelrfqlamgqlkntslikltkrdiariktilrer
elgirr

SCOPe Domain Coordinates for d1r73a_:

Click to download the PDB-style file with coordinates for d1r73a_.
(The format of our PDB-style files is described here.)

Timeline for d1r73a_: