SCOPe 2.08: Domain d1r73a_: 1r73 A:

Lineage for d1r73a_ (1r73 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)
   automatically mapped to Pfam PF00831

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (5 species)

7. Species Thermotoga maritima [TaxId:2336] [109630] (1 PDB entry)
   Uniprot P38514

8. Domain d1r73a_: 1r73 A: [104827]
   Structural genomics target

Details for d1r73a_

PDB Entry: 1r73

PDB Description: solution structure of tm1492, the l29 ribosomal protein from thermotoga maritima

PDB Compounds: (A:) 50S ribosomal protein L29

SCOPe Domain Sequences for d1r73a_:

Sequence; same for both SEQRES and ATOM records:

>d1r73a_ a.2.2.1 (A:) Ribosomal protein L29 (L29p) {Thermotoga maritima [TaxId: 2336]}
mkaselrnytdeelknlleekkrqlmelrfqlamgqlkntslikltkrdiariktilrer
elgirr

Timeline for d1r73a_:

• d1r73a_ first appeared in SCOP 1.69
  
• d1r73a_ appears in SCOPe 2.07