Class a: All alpha proteins [46456] (290 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) automatically mapped to Pfam PF00831 |
Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein) |
Protein Ribosomal protein L29 (L29p) [46563] (5 species) |
Species Thermotoga maritima [TaxId:2336] [109630] (1 PDB entry) Uniprot P38514 |
Domain d1r73a_: 1r73 A: [104827] Structural genomics target |
PDB Entry: 1r73 (more details)
SCOPe Domain Sequences for d1r73a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r73a_ a.2.2.1 (A:) Ribosomal protein L29 (L29p) {Thermotoga maritima [TaxId: 2336]} mkaselrnytdeelknlleekkrqlmelrfqlamgqlkntslikltkrdiariktilrer elgirr
Timeline for d1r73a_: