Class a: All alpha proteins [46456] (218 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.14: KorB DNA-binding domain-like [109709] (1 family) contains HTH motif in the common core; also contains extra N-terminal helix and C-terminal subdomain of 4 helices (left-handed superhelix) |
Family a.4.14.1: KorB DNA-binding domain-like [109710] (2 proteins) [N-terminal half of Pfam 06613] |
Protein Transcriptional repressor protein KorB DNA-binding domain [109711] (1 species) |
Species Escherichia coli [TaxId:562] [109712] (1 PDB entry) |
Domain d1r71d_: 1r71 D: [104826] |
PDB Entry: 1r71 (more details), 2.2 Å
SCOP Domain Sequences for d1r71d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r71d_ a.4.14.1 (D:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli} neadqvienlqrneltpreiadfigrelakgkkkgdiakeigkspafitqhvtlldlpek iadafntgrvrdvtvvnelvtafkkrpeeveawldddtqeitrgtvkllreflde
Timeline for d1r71d_: