SCOP 1.69: Domain d1r71d_: 1r71 D:

Lineage for d1r71d_ (1r71 D:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.14: KorB DNA-binding domain-like [109709] (1 family)
   contains HTH motif in the common core; also contains extra N-terminal helix and C-terminal subdomain of 4 helices (left-handed superhelix)

5. Family a.4.14.1: KorB DNA-binding domain-like [109710] (2 proteins)
   [N-terminal half of Pfam 06613]

6. Protein Transcriptional repressor protein KorB DNA-binding domain [109711] (1 species)

7. Species Escherichia coli [TaxId:562] [109712] (1 PDB entry)

8. Domain d1r71d_: 1r71 D: [104826]

Details for d1r71d_

PDB Entry: 1r71, 2.2 Å

PDB Description: crystal structure of the dna binding domain of korb in complex with the operator dna

SCOP Domain Sequences for d1r71d_:

Sequence; same for both SEQRES and ATOM records:

>d1r71d_ a.4.14.1 (D:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli}
neadqvienlqrneltpreiadfigrelakgkkkgdiakeigkspafitqhvtlldlpek
iadafntgrvrdvtvvnelvtafkkrpeeveawldddtqeitrgtvkllreflde

Timeline for d1r71d_:

• d1r71d_ is new in SCOP 1.69
  
• d1r71d_ appears in SCOP 1.71
  
• d1r71d_ appears in the current release, SCOPe 2.08