![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.14: KorB DNA-binding domain-like [109709] (1 family) ![]() contains HTH motif in the common core; also contains extra N-terminal helix and C-terminal subdomain of 4 helices (left-handed superhelix) |
![]() | Family a.4.14.1: KorB DNA-binding domain-like [109710] (2 proteins) [N-terminal half of Pfam 06613] |
![]() | Protein Transcriptional repressor protein KorB DNA-binding domain [109711] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [109712] (1 PDB entry) |
![]() | Domain d1r71c_: 1r71 C: [104825] |
PDB Entry: 1r71 (more details), 2.2 Å
SCOP Domain Sequences for d1r71c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r71c_ a.4.14.1 (C:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli} adqvienlqrneltpreiadfigrelakgkkkgdiakeigkspafitqhvtlldlpekia dafntgrvrdvtvvnelvtafkkrpeeveawldddtqeitrgtvkllrefld
Timeline for d1r71c_: