Lineage for d1r71b_ (1r71 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1985321Superfamily a.4.14: KorB DNA-binding domain-like [109709] (1 family) (S)
    contains HTH motif in the common core; also contains extra N-terminal helix and C-terminal subdomain of 4 helices (left-handed superhelix)
  5. 1985322Family a.4.14.1: KorB DNA-binding domain-like [109710] (2 proteins)
    [N-terminal half of Pfam PF06613]
  6. 1985333Protein Transcriptional repressor protein KorB DNA-binding domain [109711] (1 species)
  7. 1985334Species Escherichia coli [TaxId:562] [109712] (1 PDB entry)
    Uniprot P07674 137-252 # structure of the C-terminal domain (297-358) is determined separately; (69244)
  8. 1985336Domain d1r71b_: 1r71 B: [104824]
    protein/DNA complex

Details for d1r71b_

PDB Entry: 1r71 (more details), 2.2 Å

PDB Description: crystal structure of the dna binding domain of korb in complex with the operator dna
PDB Compounds: (B:) Transcriptional repressor protein KorB

SCOPe Domain Sequences for d1r71b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r71b_ a.4.14.1 (B:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli [TaxId: 562]}
yneadqvienlqrneltpreiadfigrelakgkkkgdiakeigkspafitqhvtlldlpe
kiadafntgrvrdvtvvnelvtafkkrpeeveawldddtqeitrgtvkllreflde

SCOPe Domain Coordinates for d1r71b_:

Click to download the PDB-style file with coordinates for d1r71b_.
(The format of our PDB-style files is described here.)

Timeline for d1r71b_: