![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.14: KorB DNA-binding domain-like [109709] (2 families) ![]() contains HTH motif in the common core; also contains extra N-terminal helix and C-terminal subdomain of 4 helices (left-handed superhelix) |
![]() | Family a.4.14.1: KorB DNA-binding domain-like [109710] (2 proteins) [N-terminal half of Pfam PF06613] |
![]() | Protein Transcriptional repressor protein KorB DNA-binding domain [109711] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [109712] (1 PDB entry) Uniprot P07674 137-252 # structure of the C-terminal domain (297-358) is determined separately; (69244) |
![]() | Domain d1r71b_: 1r71 B: [104824] protein/DNA complex |
PDB Entry: 1r71 (more details), 2.2 Å
SCOPe Domain Sequences for d1r71b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r71b_ a.4.14.1 (B:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli [TaxId: 562]} yneadqvienlqrneltpreiadfigrelakgkkkgdiakeigkspafitqhvtlldlpe kiadafntgrvrdvtvvnelvtafkkrpeeveawldddtqeitrgtvkllreflde
Timeline for d1r71b_: