Lineage for d1r71a_ (1r71 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 439407Superfamily a.4.14: KorB DNA-binding domain-like [109709] (1 family) (S)
    contains HTH motif in the common core; also contains extra N-terminal helix and C-terminal subdomain of 4 helices (left-handed superhelix)
  5. 439408Family a.4.14.1: KorB DNA-binding domain-like [109710] (2 proteins)
    [N-terminal half of Pfam 06613]
  6. 439419Protein Transcriptional repressor protein KorB DNA-binding domain [109711] (1 species)
  7. 439420Species Escherichia coli [TaxId:562] [109712] (1 PDB entry)
  8. 439421Domain d1r71a_: 1r71 A: [104823]

Details for d1r71a_

PDB Entry: 1r71 (more details), 2.2 Å

PDB Description: crystal structure of the dna binding domain of korb in complex with the operator dna

SCOP Domain Sequences for d1r71a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r71a_ a.4.14.1 (A:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli}
eadqvienlqrneltpreiadfigrelakgkkkgdiakeigkspafitqhvtlldlpeki
adafntgrvrdvtvvnelvtafkkrpeeveawldddtqeitrgtvkllreflde

SCOP Domain Coordinates for d1r71a_:

Click to download the PDB-style file with coordinates for d1r71a_.
(The format of our PDB-style files is described here.)

Timeline for d1r71a_: