Lineage for d1r6pa_ (1r6p A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1994753Family a.39.1.5: Calmodulin-like [47502] (24 protein domains)
    Duplication: made with two pairs of EF-hands
  6. 1995233Protein Troponin C [47503] (6 species)
  7. 1995295Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [109819] (2 PDB entries)
    Uniprot Q7ZZB9 1-89
  8. 1995297Domain d1r6pa_: 1r6p A: [104822]
    complexed with ca

Details for d1r6pa_

PDB Entry: 1r6p (more details)

PDB Description: NMR structure of the N-terminal domain of trout cardiac troponin C at 7 C
PDB Compounds: (A:) troponin c

SCOPe Domain Sequences for d1r6pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6pa_ a.39.1.5 (A:) Troponin C {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
mndiykaaveqltdeqknefkaafdifiqdaedgcistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrcmkdds

SCOPe Domain Coordinates for d1r6pa_:

Click to download the PDB-style file with coordinates for d1r6pa_.
(The format of our PDB-style files is described here.)

Timeline for d1r6pa_: