Class a: All alpha proteins [46456] (218 folds) |
Fold a.168: SopE-like GEF domain [81831] (1 superfamily) multihelical; consists of two all-alpha subdomains each containing a 3-helical bundle with right-handed twist |
Superfamily a.168.1: SopE-like GEF domain [81832] (1 family) |
Family a.168.1.1: SopE-like GEF domain [81833] (2 proteins) C-terminal part of Pfam 05364 |
Protein Effector protein SopE2 [109939] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [109940] (2 PDB entries) |
Domain d1r6ea_: 1r6e A: [104821] |
PDB Entry: 1r6e (more details)
SCOP Domain Sequences for d1r6ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r6ea_ a.168.1.1 (A:) Effector protein SopE2 {Salmonella typhimurium} egravltsktvkdfmlqklnsldikgnaskdpayarqtceailsavysnnkdqcckllis kgvsitpflkeigeaaqnaglpgeikngvftpggaganpfvvpliasasikyphmfinhn qqvsfkayaekivmkevtplfnkgtmptpqqfqltieniankylqnas
Timeline for d1r6ea_: