SCOPe 2.07: Domain d1r6bx2: 1r6b X:169-436

Lineage for d1r6bx2 (1r6b X:169-436)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein ClpA, an Hsp100 chaperone, AAA+ modules [82421] (1 species)
   duplication: two AAA+ modules; the first module is structurally similar to the CDC6 module whereas the second module to the HslU module

7. Species Escherichia coli [TaxId:562] [82422] (2 PDB entries)
   Uniprot Q83LR6

8. Domain d1r6bx2: 1r6b X:169-436 [104819]
   Other proteins in same PDB: d1r6bx1
   complexed with adp, mg

Details for d1r6bx2

PDB Entry: 1r6b, 2.25 Å

PDB Description: high resolution crystal structure of clpa

PDB Compounds: (X:) ClpA protein

SCOPe Domain Sequences for d1r6bx2:

Sequence, based on SEQRES records:

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}
lenfttnlnqlarvggidpligrekeleraiqvlcrrrknnpllvgesgvgktaiaegla
wrivqgdvpevmadctiysldigsllagtkyrgdfekrfkallkqleqdtnsilfideih
tiigagaasggqvdaanlikpllssgkirvigsttyqefsnifekdralarrfqkidite
psieetvqiinglkpkyeahhdvrytakavraavelavkyindrhlpdkaidvideagar
arlmpvskrkktvnvadiesvvariari

Sequence, based on observed residues (ATOM records):

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}
lenfttnlnqlarvggidpligrekeleraiqvlcrrrknnpllvgesgvgktaiaegla
wrivqgdvpevmadctiysldigagtkyrgdfekrfkallkqleqdtnsilfideihtii
gagaasggqvdaanlikpllssgkirvigsttyqefsnifekdralarrfqkiditepsi
eetvqiinglkpkyeahhdvrytakavraavelavkyindrhlpdkaidvideagararl
mpvskrkktvnvadiesvvariari

Timeline for d1r6bx2:

• d1r6bx2 first appeared in SCOP 1.69
  
• d1r6bx2 appears in SCOPe 2.06
  
• d1r6bx2 appears in the current release, SCOPe 2.08