Lineage for d1r62a_ (1r62 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973838Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 2973881Protein Nitrogen regulation protein NtrB, C-terminal domain [111143] (1 species)
  7. 2973882Species Escherichia coli [TaxId:562] [111144] (1 PDB entry)
    Uniprot P06712 194-349
  8. 2973883Domain d1r62a_: 1r62 A: [104816]

Details for d1r62a_

PDB Entry: 1r62 (more details), 1.6 Å

PDB Description: Crystal structure of the C-terminal Domain of the Two-Component System Transmitter Protein NRII (NtrB)
PDB Compounds: (A:) Nitrogen regulation protein NR(II)

SCOPe Domain Sequences for d1r62a_:

Sequence, based on SEQRES records: (download)

>d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]}
rvtesihkvaervvtlvsmelpdnvrlirdydpslpelahdpdqieqvllnivrnalqal
gpeggeiilrtrtafqltlhgeryrlaaridvedngpgipphlqdtlfypmvsgreggtg
lglsiarnlidqhsgkieftswpghtefsvylpirk

Sequence, based on observed residues (ATOM records): (download)

>d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]}
rvtesihkvaervvtlvsmelpdnvrlirdydpslpelahdpdqieqvllnivrnalqal
gpeggeiilrtrtafqltlhgeryrlaaridvedngpgiglglsiarnlidqhsgkieft
swpghtefsvylpirk

SCOPe Domain Coordinates for d1r62a_:

Click to download the PDB-style file with coordinates for d1r62a_.
(The format of our PDB-style files is described here.)

Timeline for d1r62a_: