SCOPe 2.01: Domain d1r5td_: 1r5t D:

Lineage for d1r5td_ (1r5t D:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.1: Cytidine deaminase [53928] (4 proteins)
   strand 5 is antiparallel to strand 4

6. Protein mono-domain cytidine deaminase [75327] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110764] (1 PDB entry)
   Uniprot Q06549

8. Domain d1r5td_: 1r5t D: [104815]
   complexed with zn

Details for d1r5td_

PDB Entry: 1r5t, 2 Å

PDB Description: the crystal structure of cytidine deaminase cdd1, an orphan c to u editase from yeast

PDB Compounds: (D:) Cytidine deaminase

SCOPe Domain Sequences for d1r5td_:

Sequence; same for both SEQRES and ATOM records:

>d1r5td_ c.97.1.1 (D:) mono-domain cytidine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysncica
ersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstgsr
skvmtmgellpmaf

Timeline for d1r5td_:

• d1r5td_ first appeared in SCOP 1.69
  
• d1r5td_ appears in SCOP 1.75
  
• d1r5td_ appears in SCOPe 2.02
  
• d1r5td_ appears in the current release, SCOPe 2.08