Lineage for d1r5td_ (1r5t D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918483Family c.97.1.1: Cytidine deaminase [53928] (4 proteins)
    strand 5 is antiparallel to strand 4
  6. 2918487Protein mono-domain cytidine deaminase [75327] (6 species)
  7. 2918502Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110764] (1 PDB entry)
    Uniprot Q06549
  8. 2918506Domain d1r5td_: 1r5t D: [104815]
    complexed with zn

Details for d1r5td_

PDB Entry: 1r5t (more details), 2 Å

PDB Description: the crystal structure of cytidine deaminase cdd1, an orphan c to u editase from yeast
PDB Compounds: (D:) Cytidine deaminase

SCOPe Domain Sequences for d1r5td_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5td_ c.97.1.1 (D:) mono-domain cytidine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysncica
ersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstgsr
skvmtmgellpmaf

SCOPe Domain Coordinates for d1r5td_:

Click to download the PDB-style file with coordinates for d1r5td_.
(The format of our PDB-style files is described here.)

Timeline for d1r5td_: