Lineage for d1r5ta_ (1r5t A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 711877Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 711878Superfamily c.97.1: Cytidine deaminase-like [53927] (4 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 711879Family c.97.1.1: Cytidine deaminase [53928] (3 proteins)
    strand 5 is antiparallel to strand 4
  6. 711888Protein mono-domain cytidine deaminase [75327] (5 species)
  7. 711903Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110764] (1 PDB entry)
  8. 711904Domain d1r5ta_: 1r5t A: [104812]

Details for d1r5ta_

PDB Entry: 1r5t (more details), 2 Å

PDB Description: the crystal structure of cytidine deaminase cdd1, an orphan c to u editase from yeast
PDB Compounds: (A:) Cytidine deaminase

SCOP Domain Sequences for d1r5ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5ta_ c.97.1.1 (A:) mono-domain cytidine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysncic
aersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstgs
rskvmtmgellpmafgpshln

SCOP Domain Coordinates for d1r5ta_:

Click to download the PDB-style file with coordinates for d1r5ta_.
(The format of our PDB-style files is described here.)

Timeline for d1r5ta_: