![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (3 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (2 families) ![]() |
![]() | Family c.97.1.1: Cytidine deaminase [53928] (2 proteins) |
![]() | Protein mono-domain cytidine deaminase [75327] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110764] (1 PDB entry) |
![]() | Domain d1r5ta_: 1r5t A: [104812] |
PDB Entry: 1r5t (more details), 2 Å
SCOP Domain Sequences for d1r5ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r5ta_ c.97.1.1 (A:) mono-domain cytidine deaminase {Baker's yeast (Saccharomyces cerevisiae)} kvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysncic aersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstgs rskvmtmgellpmafgpshln
Timeline for d1r5ta_: