Lineage for d1r5oa3 (1r5o A:215-459)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110500Protein Eukaryotic peptide chain release factor ERF2, G domain [110535] (1 species)
  7. 2110501Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [110536] (3 PDB entries)
    Uniprot O74718
  8. 2110504Domain d1r5oa3: 1r5o A:215-459 [104811]
    Other proteins in same PDB: d1r5oa1, d1r5oa2
    complexed with gnp

Details for d1r5oa3

PDB Entry: 1r5o (more details), 3.2 Å

PDB Description: crystal structure analysis of sup35 complexed with GMPPNP
PDB Compounds: (A:) Eukaryotic peptide chain release factor GTP-binding subunit

SCOPe Domain Sequences for d1r5oa3:

Sequence, based on SEQRES records: (download)

>d1r5oa3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
tedatdlqnevdqellkdmygkehvnivfighvdagkstlggnilfltgmvdkrtmekie
reakeagkeswylswaldstseerekgktvevgrayfetehrrfslldapghkgyvtnmi
ngasqadigvlvisarrgefeagferggqtrehavlartqginhlvvvinkmdepsvqws
eerykecvdklsmflrrvagynsktdvkympvsaytgqnvkdrvdssvcpwyqgpslley
ldsmt

Sequence, based on observed residues (ATOM records): (download)

>d1r5oa3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
tedatdlqnevdqellkdmygkehvnivfighvdagkstlggnilfltgmvdkrtmekie
reakerayfetehrrfslldapgasqadigvlvisarrgefeagferggqtrehavlart
qginhlvvvinkmdepsvqwseerykecvdklsmflrrvagynsktdvkympvsaytgqn
vkdrvdssvcpwyqgpslleyldsmt

SCOPe Domain Coordinates for d1r5oa3:

Click to download the PDB-style file with coordinates for d1r5oa3.
(The format of our PDB-style files is described here.)

Timeline for d1r5oa3: