Class b: All beta proteins [48724] (176 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
Protein Eukaryotic peptide chain release factor ERF2, C-terminal domain [110229] (1 species) |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [110230] (3 PDB entries) Uniprot O74718 |
Domain d1r5na2: 1r5n A:555-622 [104807] Other proteins in same PDB: d1r5na1, d1r5na3 complexed with gdp |
PDB Entry: 1r5n (more details), 2.9 Å
SCOPe Domain Sequences for d1r5na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r5na2 b.44.1.1 (A:555-622) Eukaryotic peptide chain release factor ERF2, C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} hattrfiaqiailelpsilttgyscvmhihtaveevsfakllhkldktnrkskkppmfat kgmkiiae
Timeline for d1r5na2: