| Class b: All beta proteins [48724] (180 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins) |
| Protein Eukaryotic peptide chain release factor ERF2, C-terminal domain [110229] (1 species) |
| Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [110230] (3 PDB entries) Uniprot O74718 |
| Domain d1r5ba2: 1r5b A:555-622 [104804] Other proteins in same PDB: d1r5ba1, d1r5ba3 |
PDB Entry: 1r5b (more details), 2.35 Å
SCOPe Domain Sequences for d1r5ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r5ba2 b.44.1.1 (A:555-622) Eukaryotic peptide chain release factor ERF2, C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
hattrfiaqiailelpsilttgyscvmhihtaveevsfakllhkldktnrkskkppmfat
kgmkiiae
Timeline for d1r5ba2: