Lineage for d1r5ba1 (1r5b A:460-554)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2402557Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2402558Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2402684Protein Eukaryotic peptide chain release factor ERF2, post-G domain [110225] (1 species)
  7. 2402685Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [110226] (3 PDB entries)
    Uniprot O74718
  8. 2402686Domain d1r5ba1: 1r5b A:460-554 [104803]
    Other proteins in same PDB: d1r5ba2, d1r5ba3

Details for d1r5ba1

PDB Entry: 1r5b (more details), 2.35 Å

PDB Description: Crystal structure analysis of sup35
PDB Compounds: (A:) Eukaryotic peptide chain release factor GTP-binding subunit

SCOPe Domain Sequences for d1r5ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
hlerkvnapfimpiaskykdlgtilegkieagsikknsnvlvmpinqtlevtaiydeade
eisssicgdqvrlrvrgddsdvqtgyvltstknpv

SCOPe Domain Coordinates for d1r5ba1:

Click to download the PDB-style file with coordinates for d1r5ba1.
(The format of our PDB-style files is described here.)

Timeline for d1r5ba1: