Lineage for d1r4ib_ (1r4i B:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586757Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2586758Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2586782Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 2586783Protein Androgen receptor [111439] (1 species)
  7. 2586784Species Norway rat (Rattus norvegicus) [TaxId:10116] [111440] (1 PDB entry)
    Uniprot P15207 538-611
  8. 2586786Domain d1r4ib_: 1r4i B: [104802]
    protein/DNA complex; complexed with zn

Details for d1r4ib_

PDB Entry: 1r4i (more details), 3.1 Å

PDB Description: Crystal Structure of Androgen Receptor DNA-Binding Domain Bound to a Direct Repeat Response Element
PDB Compounds: (B:) Androgen receptor

SCOPe Domain Sequences for d1r4ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4ib_ g.39.1.2 (B:) Androgen receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ktclicgdeasgahygaltcgsckvffkraaegkqkylcasrndctidkfrrkncpscrl
rkcyeagmtlg

SCOPe Domain Coordinates for d1r4ib_:

Click to download the PDB-style file with coordinates for d1r4ib_.
(The format of our PDB-style files is described here.)

Timeline for d1r4ib_: