Lineage for d1r4ch_ (1r4c H:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. Family d.17.1.2: Cystatins [54407] (7 proteins)
    automatically mapped to Pfam PF00031
  6. Protein Cystatin C [64231] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [64232] (11 PDB entries)
    Uniprot P01034 37-146
  8. Domain d1r4ch_: 1r4c H: [104800]
    dimeric form with segment-swapping

Details for d1r4ch_

PDB Entry: 1r4c (more details), 2.18 Å

PDB Description: n-truncated human cystatin c; dimeric form with 3d domain swapping
PDB Compounds: (H:) Cystatin C

SCOPe Domain Sequences for d1r4ch_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4ch_ d.17.1.2 (H:) Cystatin C {Human (Homo sapiens) [TaxId: 9606]}
ggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelgr
ttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda

SCOPe Domain Coordinates for d1r4ch_ are not available.

Timeline for d1r4ch_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r4ca_, d1r4cb_, d1r4cc_, d1r4cd_, d1r4ce_, d1r4cf_, d1r4cg_