SCOP 1.69: Domain d1r4cf_: 1r4c F:

Lineage for d1r4cf_ (1r4c F:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (3 families)
   has a additional strand at the N-terminus

5. Family d.17.1.2: Cystatins [54407] (6 proteins)

6. Protein Cystatin C [64231] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64232] (2 PDB entries)

8. Domain d1r4cf_: 1r4c F: [104798]

Details for d1r4cf_

PDB Entry: 1r4c, 2.18 Å

PDB Description: n-truncated human cystatin c; dimeric form with 3d domain swapping

SCOP Domain Sequences for d1r4cf_:

Sequence; same for both SEQRES and ATOM records:

>d1r4cf_ d.17.1.2 (F:) Cystatin C {Human (Homo sapiens)}
ggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelgr
ttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda

Timeline for d1r4cf_:

• d1r4cf_ is new in SCOP 1.69
  
• d1r4cf_ appears in SCOP 1.71
  
• d1r4cf_ appears in the current release, SCOPe 2.08