Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.2: Cystatins [54407] (7 proteins) automatically mapped to Pfam PF00031 |
Protein Cystatin C [64231] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64232] (11 PDB entries) Uniprot P01034 37-146 |
Domain d1r4ce_: 1r4c E: [104797] dimeric form with segment-swapping |
PDB Entry: 1r4c (more details), 2.18 Å
SCOPe Domain Sequences for d1r4ce_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r4ce_ d.17.1.2 (E:) Cystatin C {Human (Homo sapiens) [TaxId: 9606]} ggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelgr ttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda
Timeline for d1r4ce_: