SCOPe 2.06: Domain d1r4ca_: 1r4c A:

Lineage for d1r4ca_ (1r4c A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.2: Cystatins [54407] (7 proteins)
   automatically mapped to Pfam PF00031

6. Protein Cystatin C [64231] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64232] (9 PDB entries)
   Uniprot P01034 37-146

8. Domain d1r4ca_: 1r4c A: [104793]
   dimeric form with segment-swapping

Details for d1r4ca_

PDB Entry: 1r4c, 2.18 Å

PDB Description: n-truncated human cystatin c; dimeric form with 3d domain swapping

PDB Compounds: (A:) Cystatin C

SCOPe Domain Sequences for d1r4ca_:

Sequence; same for both SEQRES and ATOM records:

>d1r4ca_ d.17.1.2 (A:) Cystatin C {Human (Homo sapiens) [TaxId: 9606]}
ggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelgr
ttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda

Timeline for d1r4ca_:

• d1r4ca_ first appeared in SCOP 1.69
  
• d1r4ca_ appears in SCOPe 2.05
  
• d1r4ca_ appears in SCOPe 2.07
  
• d1r4ca_ appears in the current release, SCOPe 2.08