SCOPe 2.07: Domain d1r44f_: 1r44 F:

Lineage for d1r44f_ (1r44 F:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families)
   zinc-binding motif

5. Family d.65.1.4: VanX-like [111022] (1 protein)
   Pfam PF01427

6. Protein D-Ala-D-Ala dipeptidase VanX [111023] (1 species)

7. Species Enterococcus faecium [TaxId:1352] [111024] (1 PDB entry)
   Uniprot Q06241

8. Domain d1r44f_: 1r44 F: [104792]
   complexed with zn

Details for d1r44f_

PDB Entry: 1r44, 2.25 Å

PDB Description: crystal structure of vanx

PDB Compounds: (F:) D-alanyl-D-alanine dipeptidase

SCOPe Domain Sequences for d1r44f_:

Sequence; same for both SEQRES and ATOM records:

>d1r44f_ d.65.1.4 (F:) D-Ala-D-Ala dipeptidase VanX {Enterococcus faecium [TaxId: 1352]}
meigftfldeivhgvrwdakyatwdnftgkpvdgyevnrivgtyelaesllkakelaatq
gyglllwdgyrpkravncfmqwaaqpennltkesyypnidrtemiskgyvasksshsrgs
aidltlyrldtgelvpmgsrfdfmdershhaangiscneaqnrrrlrsimensgfeaysl
ewwhyvlrdepypnsyfdfpvk

Timeline for d1r44f_:

• d1r44f_ first appeared in SCOP 1.69
  
• d1r44f_ appears in SCOPe 2.06
  
• d1r44f_ appears in the current release, SCOPe 2.08