Lineage for d1r44d_ (1r44 D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605354Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 605355Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (4 families) (S)
    zinc-binding motif
  5. 605375Family d.65.1.4: VanX-like [111022] (1 protein)
    Pfam 01427
  6. 605376Protein D-Ala-D-Ala dipeptidase VanX [111023] (1 species)
  7. 605377Species Enterococcus faecium [TaxId:1352] [111024] (1 PDB entry)
  8. 605381Domain d1r44d_: 1r44 D: [104790]

Details for d1r44d_

PDB Entry: 1r44 (more details), 2.25 Å

PDB Description: crystal structure of vanx

SCOP Domain Sequences for d1r44d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r44d_ d.65.1.4 (D:) D-Ala-D-Ala dipeptidase VanX {Enterococcus faecium}
meigftfldeivhgvrwdakyatwdnftgkpvdgyevnrivgtyelaesllkakelaatq
gyglllwdgyrpkravncfmqwaaqpennltkesyypnidrtemiskgyvasksshsrgs
aidltlyrldtgelvpmgsrfdfmdershhaangiscneaqnrrrlrsimensgfeaysl
ewwhyvlrdepypnsyfdfpvk

SCOP Domain Coordinates for d1r44d_:

Click to download the PDB-style file with coordinates for d1r44d_.
(The format of our PDB-style files is described here.)

Timeline for d1r44d_: