Lineage for d1r44b_ (1r44 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199430Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2199431Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. 2199491Family d.65.1.4: VanX-like [111022] (1 protein)
    Pfam PF01427
  6. 2199492Protein D-Ala-D-Ala dipeptidase VanX [111023] (1 species)
  7. 2199493Species Enterococcus faecium [TaxId:1352] [111024] (1 PDB entry)
    Uniprot Q06241
  8. 2199495Domain d1r44b_: 1r44 B: [104788]
    complexed with zn

Details for d1r44b_

PDB Entry: 1r44 (more details), 2.25 Å

PDB Description: crystal structure of vanx
PDB Compounds: (B:) D-alanyl-D-alanine dipeptidase

SCOPe Domain Sequences for d1r44b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r44b_ d.65.1.4 (B:) D-Ala-D-Ala dipeptidase VanX {Enterococcus faecium [TaxId: 1352]}
meigftfldeivhgvrwdakyatwdnftgkpvdgyevnrivgtyelaesllkakelaatq
gyglllwdgyrpkravncfmqwaaqpennltkesyypnidrtemiskgyvasksshsrgs
aidltlyrldtgelvpmgsrfdfmdershhaangiscneaqnrrrlrsimensgfeaysl
ewwhyvlrdepypnsyfdfpvk

SCOPe Domain Coordinates for d1r44b_:

Click to download the PDB-style file with coordinates for d1r44b_.
(The format of our PDB-style files is described here.)

Timeline for d1r44b_: