Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.7: Mob1/phocein [101152] (2 families) common fold is elaborated with additional short helices; contains a zinc-binding site automatically mapped to Pfam PF03637 |
Family a.29.7.1: Mob1/phocein [101153] (2 proteins) |
Protein Mob1a [101154] (2 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [109796] (1 PDB entry) Uniprot Q7T1M9 33-215 |
Domain d1r3ba1: 1r3b A:18-215 [104786] Other proteins in same PDB: d1r3ba2 |
PDB Entry: 1r3b (more details)
SCOPe Domain Sequences for d1r3ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r3ba1 a.29.7.1 (A:18-215) Mob1a {African clawed frog (Xenopus laevis) [TaxId: 8355]} hhhhhhssglvprgsatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitef ctestcsvmsagpryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigv pfpknfmsvaktilkrlfrvyahiyhqhfdavmqlqeeahlntsfkhfiffvqefnlidr relaplqelieklgskdr
Timeline for d1r3ba1: