Lineage for d1r3ba_ (1r3b A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442020Fold a.29: Bromodomain-like [47363] (6 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 442121Superfamily a.29.7: Mob1/phocein [101152] (1 family) (S)
    common fold is elaborated with additional short helices; contains a zinc-binding site
  5. 442122Family a.29.7.1: Mob1/phocein [101153] (1 protein)
  6. 442123Protein Mob1a [101154] (2 species)
  7. 442124Species African clawed frog (Xenopus laevis) [TaxId:8355] [109796] (1 PDB entry)
  8. 442125Domain d1r3ba_: 1r3b A: [104786]

Details for d1r3ba_

PDB Entry: 1r3b (more details)

PDB Description: solution structure of xenopus laevis mob1

SCOP Domain Sequences for d1r3ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3ba_ a.29.7.1 (A:) Mob1a {African clawed frog (Xenopus laevis)}
mgsshhhhhhssglvprgsatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygt
itefctestcsvmsagpryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfps
kigvpfpknfmsvaktilkrlfrvyahiyhqhfdavmqlqeeahlntsfkhfiffvqefn
lidrrelaplqelieklgskdr

SCOP Domain Coordinates for d1r3ba_:

Click to download the PDB-style file with coordinates for d1r3ba_.
(The format of our PDB-style files is described here.)

Timeline for d1r3ba_: