Class a: All alpha proteins [46456] (218 folds) |
Fold a.29: Bromodomain-like [47363] (6 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.7: Mob1/phocein [101152] (1 family) common fold is elaborated with additional short helices; contains a zinc-binding site |
Family a.29.7.1: Mob1/phocein [101153] (1 protein) |
Protein Mob1a [101154] (2 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [109796] (1 PDB entry) |
Domain d1r3ba_: 1r3b A: [104786] |
PDB Entry: 1r3b (more details)
SCOP Domain Sequences for d1r3ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r3ba_ a.29.7.1 (A:) Mob1a {African clawed frog (Xenopus laevis)} mgsshhhhhhssglvprgsatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygt itefctestcsvmsagpryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfps kigvpfpknfmsvaktilkrlfrvyahiyhqhfdavmqlqeeahlntsfkhfiffvqefn lidrrelaplqelieklgskdr
Timeline for d1r3ba_: